PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3NG009200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 418aa    MW: 45304.6 Da    PI: 6.862
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3NG009200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2676.2e-82223875374
                 GRAS   5 LlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlar.svselykal.ppsetseknsseelaalklfsevsPil 91 
                          L ecA      d e+a ++L++   la+ ++  p+ Rla  ++  La+rl + +v+ +++al  ps+    +     aa++ f+e+sP++
  Pavir.3NG009200.1.p  22 LCECAA-----DVEAAARCLSQATGLAAAARdGPLPRLAVPVADCLARRLIHpMVPAVADALiDPSDH--LDRRCLRAARRSFFELSPFP 104
                          555555.....6778999****99996555538*****************998999999988444433..345556678999******** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfd..isqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                          k +  + N+ Ilea+e+e+ vH+iDf   + q+ QW+ Ll+ + sRpeg+p+lR+T v++    + e l ++ e La+ A++l+vpf+ +
  Pavir.3NG009200.1.p 105 KAAVAVGNRVILEAMENEKNVHVIDFArpAAQPCQWVRLLRDFHSRPEGAPHLRLTIVHD----DGEFLAKVSESLADEADKLDVPFQAH 190
                          **************************75589*****************************....9************************* PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                            va ++e+l++++L+   g + a  l +    l   + +++ +   +L++ +  sPk+vv++eqea hn++sF +r++eal+yy+a +d
  Pavir.3NG009200.1.p 191 C-VAGQIETLDPNDLHGVLGLNPATPLGFVSPPLTTPPFQMPAALVGFLSAAQAASPKIVVLAEQEAGHNGASFRKRVAEALSYYAAAYD 279
                          *.799**********98887777777777777777779999999999******************************************* PP

                 GRAS 270 sleaklpres...eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesg 356
                          sl+a +++      er+ vEr++lg+e+++v+  ega+rrerh +l++W +r+e aGF+ vpls+ a  q    lr++++ g +  e++g
  Pavir.3NG009200.1.p 280 SLDAAAAAYRrpaAERAEVERAVLGEEVRDVLLREGARRRERHDRLHQWARRMEVAGFRGVPLSYAALRQGVDTLRRCGVGGCESREHEG 369
                          **777554434559**************************************************************************** PP

                 GRAS 357 slvlgWkdrpLvsvSaWr 374
                          +l+l+W++ pL+svSaWr
  Pavir.3NG009200.1.p 370 CLLLCWRSWPLYSVSAWR 387
                          *****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098536.9061367IPR005202Transcription factor GRAS
PfamPF035142.1E-7922387IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MHPPPPTENG PASRLARLGR ALCECAADVE AAARCLSQAT GLAAAARDGP LPRLAVPVAD  60
CLARRLIHPM VPAVADALID PSDHLDRRCL RAARRSFFEL SPFPKAAVAV GNRVILEAME  120
NEKNVHVIDF ARPAAQPCQW VRLLRDFHSR PEGAPHLRLT IVHDDGEFLA KVSESLADEA  180
DKLDVPFQAH CVAGQIETLD PNDLHGVLGL NPATPLGFVS PPLTTPPFQM PAALVGFLSA  240
AQAASPKIVV LAEQEAGHNG ASFRKRVAEA LSYYAAAYDS LDAAAAAYRR PAAERAEVER  300
AVLGEEVRDV LLREGARRRE RHDRLHQWAR RMEVAGFRGV PLSYAALRQG VDTLRRCGVG  360
GCESREHEGC LLLCWRSWPL YSVSAWRPDR GSAYGVGSGY LSPSAPPDHC FDEELMC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-264438731375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980153.20.0PREDICTED: scarecrow-like protein 3
TrEMBLK3ZNT20.0K3ZNT2_SETIT; Uncharacterized protein
STRINGSi028262m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.15e-29scarecrow-like 3